PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sof012633
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Saccharinae; Saccharum; Saccharum officinarum complex
Family MYB_related
Protein Properties Length: 226aa    MW: 25458.2 Da    PI: 10.0644
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PUT-157a-Saccharum_officinarum-698133728PU_refplantGDBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding50.16.4e-162468147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     r rWT+ E++++++a k++G   W +I +++g ++t+ q++s+ qk+
        Sof012633 24 RERWTEAEHKRFLEALKLYGRA-WQRIEEHVG-TKTAVQIRSHAQKF 68
                     78******************88.*********.************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466894.86E-171874IPR009057Homeodomain-like
PROSITE profilePS5129419.1471973IPR017930Myb domain
TIGRFAMsTIGR015573.1E-172271IPR006447Myb domain, plants
SMARTSM007176.5E-122371IPR001005SANT/Myb domain
PfamPF002492.9E-132467IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.5E-82464IPR009057Homeodomain-like
CDDcd001677.49E-92669No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 226 aa     Download sequence    Send to blast
MELNSSGEET VVKVRKPYTI TKQRERWTEA EHKRFLEALK LYGRAWQRIE EHVGTKTAVQ  60
IRSHAQKFFT KLEKEAMNNG TSPGQAHDID IPPPRPKRKP NSPYPRKSGL SSETTTKELP  120
NDKSTKPNMP LSNGNVQMAG DASLQKFQRK ELSEKGSCSE VLNLFRDAPS ASFSSVNKSS  180
SNHGAPRGIE ASKTKIRDMT IMENNSLNPN TQEDVKENSD QENEKX
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008661386.11e-134PREDICTED: LHY protein isoform X2
RefseqXP_008661387.11e-135PREDICTED: LHY protein isoform X3
TrEMBLA0A0C6WCN01e-140A0A0C6WCN0_9POAL; ScMYB43 protein
STRINGSb07g003870.11e-128(Sorghum bicolor)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G01060.32e-44MYB_related family protein